PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013602607.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 254aa    MW: 28966.4 Da    PI: 5.4355
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013602607.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.89.3e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEd+ lv +++++G  +W++ +++ g+ R++k+c++rw++yl
   XP_013602607.1 14 KGEWTAEEDQNLVAYINEHGVSDWRSLPKRAGLQRCGKSCRLRWLNYL 61
                     799*******************************************97 PP

2Myb_DNA-binding574.5e-1867111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T++E+e ++++++ lG++ W++Ia++m  +Rt++++k++w++ 
   XP_013602607.1  67 RGKFTPQEEEEIIKLHAVLGNR-WAAIAKEMD-NRTDNDIKNHWNSC 111
                      89********************.*********.***********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.33961IPR017930Myb domain
SuperFamilySSF466891.35E-2911108IPR009057Homeodomain-like
SMARTSM007171.1E-131363IPR001005SANT/Myb domain
PfamPF002493.1E-151461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.4E-241568IPR009057Homeodomain-like
CDDcd001671.25E-101661No hitNo description
PROSITE profilePS5129426.71962116IPR017930Myb domain
SMARTSM007173.8E-1666114IPR001005SANT/Myb domain
PfamPF002491.7E-1667111IPR001005SANT/Myb domain
CDDcd001677.09E-1169109No hitNo description
Gene3DG3DSA:1.10.10.603.7E-2569116IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009753Biological Processresponse to jasmonic acid
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MGRKTWVDGD GMKKGEWTAE EDQNLVAYIN EHGVSDWRSL PKRAGLQRCG KSCRLRWLNY  60
LRPGIKRGKF TPQEEEEIIK LHAVLGNRWA AIAKEMDNRT DNDIKNHWNS CLKKRLSRKG  120
IDPMTHEPII NNLTVTITNE ECGSSSITTF SPTSSPSGSA CLLNKLATGI SSRHHDLDRI  180
KSILLEPRIA SSDQDEKEEV KRDHTIGGGE EGDDFLIWDD EEVRRFMESD EMEYGTTPYV  240
SLFYESTHVL DDLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-26141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF9747531e-159KF974753.1 Brassica napus MYB transcription factor 47 (MYB47.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013602606.10.0PREDICTED: transcription factor MYB34-like isoform X1
SwissprotO643998e-59MYB34_ARATH; Transcription factor MYB34
TrEMBLA0A0D3DWM11e-177A0A0D3DWM1_BRAOL; Uncharacterized protein
STRINGBra031041.1-P1e-152(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18710.11e-118myb domain protein 47